SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00014.9|PACid:22025340 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00014.9|PACid:22025340
Domain Number 1 Region: 221-399,562-680
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-40
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 
Domain Number 2 Region: 55-299
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.34e-29
Family WD40-repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 703-852
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000102
Family YVTN repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00014.9|PACid:22025340
Sequence length 858
Sequence
MLKHPRTPPSNHVDYPSGDSDHVAKRTRPLGISDEVNLPVSISPVTYMGQSHNSAFSTDD
LPKTVARTFSQGSSPMSMDFHPRQQTLLLVGTNVGDIALWEVGSRERLFLRNFKVWDLGA
CSMPLQASLVKDPSVAVNRIIWNPDGSLFGVAYSRHIVQIYAYHGGDDVRQHLEIDAHVG
GVNDLAFSHPNKQLCVVTCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFI
FSTALDGKIKAWLYDNLGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESYIVEWNE
SEGAVKRTYLGFRKRSAGVVQFDTTKNRFLAAGDEFVIKIWDMDNVNLLTTMDAEGGLPA
SPRIRFNKEGTLLAVSANDNAIKVLATTDGLRLLRTFENRSFDASRAASEAVSKPSINPI
SAAAAAAAAAATSAGHADIGASVVSISGMNGDARNMGDVKPRITEEANDKSKIWKLTEIS
DGAQCRTMRLPDSIRSSKISRLIYTNTGTAILGLASNAVHFLWKWQRNERNSSGKATANV
PPTLWQPSSGILMTNDIADVNPEECVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTF
MPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHALN
VLVSSGADAQICVWNSDGWEKQKSRFLQIPAGRNPAALSDTRVQFHQDQIHFLVVHETQL
AIYETTKLECLKQWVPRESSAPISHATLSCDSQLVYASFLDATVCIFGAANLRLRCRINP
TAYLPANVSASIHPLVIAAHPQEPNQFALGLTDGGVHVFEPLESEGKWGVPPPVENGSGS
GMPSAPAVGTSGSDQPQR
Download sequence
Identical sequences A0A2G5DFG4
Aquca_020_00014.9|PACid:22025340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]