SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00089.4|PACid:22025366 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00089.4|PACid:22025366
Domain Number 1 Region: 336-647
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.05e-40
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 816-1079
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-32
Family WD40-repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00089.4|PACid:22025366
Domain Number - Region: 81-136
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0429
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00089.4|PACid:22025366
Sequence length 1112
Sequence
MSSLSRELVFLILQFLDEEKFRETVHKLEQESGFFFNMKYFEDSVNNGEWDDVEKYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNDELFKEITQLLT
LENFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN
WQHQLCKNPRSNPDIKTLFVDHSCGPPNGARAPSPVTNPLMAMPKPSGGFPPLGAHGPFQ
PGPAPLATSLAGWMANPSSVPHPAASGGPISLGAPNNADSEHLMKRSRPLGMSDEANNLP
VNIMPMTYTGQNNAQSLYSSDELPKNVVMTLNQGSAVRSMDFHPGQPTLLLVGTIVGDVA
VWELGSRERLALRNFKVWDIGTCSGPLQTALVKEPAIAVNRVAWSPDGALFGVAYNKHIV
HVYSYHNSDDIRHHLEIDAHIGSVNDLAFSHPNKQLCIVTCGDDKAIKVWDAVTGSKQYT
FEGHEAPVFSVCPHYKESIQFIFSTAMDGKIKAWLYDNMGSRVDYDAPGHCCTTMSYSAD
GTRLFSCGTSKDGDSYLVEWNESEGAVKRTYQGFRKRSNGVVQFDTTKNRFLAVGDEFVI
KIWDMDNPNLLTTIETDGGLPASPRIRFNKEGMMLAVSTNDNGIKILANTDGLRLLHSFE
ASRSASETVAKPSPISTMGAASVNVGTSVGIADRGAPMTSIIGMNGDSRSLADVKPRILD
ESMEKSKIWKLTEINELSQCRSLRLPDNVLPMRVSRLIYTNSGLAILALASNAVHKLWKW
PRNERYPSGKASSVVPPQLWQPSSGILMTNEISEANPEDAVPCFALSKNDSYVMSASGGK
ISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKG
HQKRVTGLAFSNVLNVLVSSGADAQLCVWSTDGWEKQVNKFLQIPSGRVPAPLAETRVQF
HQDQIHFLTVHETQLAIYEAPKLECVKQWVPQEPSVTITHATYSCDSQSIYASFGDGSVG
VLSATTLRLRCRINPTAYLPSSINSNNSRVYPLVIAAHPTEPNQFALGLTDGGVHVLEPL
ESEGKWGTLPPSDNGAGPSIATGQGSSEQLTR
Download sequence
Identical sequences A0A2G5DFX3
Aquca_020_00089.4|PACid:22025366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]