SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00106.1|PACid:22024865 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00106.1|PACid:22024865
Domain Number 1 Region: 479-794
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-80
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 84-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.23e-25
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00106.1|PACid:22024865
Sequence length 826
Sequence
MGTWVSFGSVVLFFSWFFILSDTCFGTTRNIGQIHPGFKGSQMNWVDNAGLFLLSNNSNF
GFGFDTTTDVTLFLLAVVHMGSSKVVWTANRDSLVRNSDNFVFDDNGNIHLESGQRIVWS
TNTTGKGATALELQNSGNLVLLGSDRTILWQSFSHPTDTLLSGQDFVEGMRLVSNPSSNN
LSYHLKIESGNMLLYVNFPTPQPYWSMGTESRRTIIKVGDDVSSASLDSNSWKIFDQRQG
LLWQFIFSRNSNPNVTWAAILGTDGVISFYNLQSTGSAVEQTKIPQDACSTPESCGSYYV
CYGENRCQCPSVLSSRNCAPGFASPCNNSKAPMQLVDVGDKVNYFALGFVSPFSKSDLDG
CKNACLQNCSCVVLFFETSSRSCYLFDQLGSLKQSDQNSAGFVSYIKVSGNGDPGGNSSG
KGGGGGQKNTQIVIIIVVVTIAVIVGLLYLGFRYHKKKKMVPEFPDDMSEEDNFLENLTG
MPIRFSYKELEDATDNFVVKLGQGGFGSVYKGKLKDGTEIAVKQLEGIGQGKKEFRAEVS
IIGSIHHTHLVKLRGFCAEGSHRLLAYEYMANGSMDKWIFKANKEGVKLDWATRYSIAVG
TAKGLAYLHEDCDVKIVHCDIKPENVLLDEHFHAKVSDFGLAKLMTREQSHVFTTLRGTR
GYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNFDHSETSERAHFPTYALKMAEEKKL
KEILDPNIKIVEEDESVYTAIQVALWCIQEDMYLRPSMSRVVQMLEGICAVPEPPTSSQM
GSRLYSSFFKSVSDGTTSSGHGTTSSGLSDYNSNAYLSAVRLSGPR
Download sequence
Identical sequences A0A2G5DFX8
Aquca_020_00106.1|PACid:22024865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]