SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00122.1|PACid:22025711 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00122.1|PACid:22025711
Domain Number 1 Region: 168-383,412-454
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-35
Family Nuclease 0.085
Further Details:      
 
Domain Number 2 Region: 6-163
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-16
Family Synaptotagmin-like (S variant) 0.057
Further Details:      
 
Domain Number 3 Region: 514-590
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000149
Family Polyphosphate kinase C-terminal domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00122.1|PACid:22025711
Sequence length 660
Sequence
MALILLHGTLHVTIFEATSLTNPDRATGDAPKFIRKKCDLILFILIKQNIEEAVGIGKGA
TQLYTTIDLERGRVGRTRLIDEPANPRWYESFHIYCAHLASNIVFSIKVANPIGATLIGR
AYLPVKELLNGQEVDRWLEILDTDRKPLHGGPRIHVKLQFFDVSLDPNWSRGIQSPKYPG
VPYTYFTQRHGCRVSLYQDAHVPDNYVPKIPLAGGKYYEPHRCWEDIFDAITNAKHLIYI
TGWSVYPEFALIRDSRRPKPGGDITLGELLKKKASEGIRVLMLVWDDRFSGDLSKDGVMG
THDEETANYFQGTDVHCVLCPRNPDNGGSFIKNIEIATMFTHHQKIVVVDSEVSYGSSER
RRIVSYVGGIDLCDGRYDTQFHSLFRTLDTAHHDDFHQPNFTGASISKGGPREPWHDIHS
RLEGPVAWDVLDNFEQRWRKQGGKDLLVQLRDLADIIMEPSPVTLPDDHETWNVQVFRSI
DGGAAFGFPNTPEAAAKVGLMMIGESFFSVFNVFLHVDDEYIIIGSANINQRSMDGARDS
EIAMGAYQPYHLSNNEPARGQIHGFRMSLWYEHLGMLDDSLLNPESLECIQKVNSIASKY
WDLYSSDTLEHDLPGHLLSYPIGVASDGMVTQLPGFEFFPDTKGRVLGTISDLYPPILTT
Download sequence
Identical sequences A0A2G5DG08
Aquca_020_00122.1|PACid:22025711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]