SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00182.5|PACid:22025498 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00182.5|PACid:22025498
Domain Number 1 Region: 3-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-80
Family WD40-repeat 0.0000584
Further Details:      
 
Domain Number 2 Region: 227-309,345-490
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-19
Family WD40-repeat 0.013
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00182.5|PACid:22025498
Domain Number - Region: 669-741
Classification Level Classification E-value
Superfamily TPR-like 0.0759
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00182.5|PACid:22025498
Sequence length 913
Sequence
MPLRLEIKRKLAQRSERVKSVDLHPTEPWLLASLYSGTVCIFNYQTQTIAKSFEVTELPV
RSSKFIARKQWVVAGSDDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSASDD
MLIKLWDWEKGWMCTQIFEGHSHYVMHVTFNPKDTNTFASSSLDRTIKIWNLGSPDPNFT
LDAHSKGVNCVDYFTGGDRPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAVAYMRGSRRVAIGYDEGTIMIKIG
REVPVASMDSSGKIIWAKHNEIQTVNIKSVGADFEVTDGERLPLAVKELGSCDLYPQSLK
HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSGLEFVWSSDGEYAVRESTSRIKIFTKAFQ
EKKTIRPTFSAERIFGGTLLAMCSNDFICFYDWAECRLIRRIDVNVKNLYWADSGDLVAI
ASDTSFYILKYSRDIVSSYLDSGKPVDEEGVEDAFELLTETNERVRTGIWVGDCFIYNNS
SWRLNYCVGGEVTTMFHLDRPMYLLGYLANQSRVYLIDKEFNVMGYTLLLSLIEYKTLVI
RGDVERANEILPSIPKDHHNSVAHFLESRGMLEDALEVATDPNYRFDLAIQLGRLDVAKE
IATEVHSESKWKQLGELAMSIGKLEMAEECLQHAMDLSGLLLLYSSLGDAEGITKLASLA
KDQGKNNVAFLCLFMLGKLEECLHLLIESNRIPEAALMARSYLPSKVSEIVAIWRNDLNK
INQKAAESLADPEEYPNLFEDWQVALAVESKTAEQRGTYPPAEEYPSCTEKSKINLVEAF
KSMQIDEEEAPLENGDSSHEVVEEDGVGEDRVEEDGEEEHQEETVEVDADSTDGGVLVNG
SEGDEEYVLTPRH
Download sequence
Identical sequences A0A2G5DGB1
Aquca_020_00182.5|PACid:22025498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]