SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00182.6|PACid:22025499 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00182.6|PACid:22025499
Domain Number 1 Region: 3-260,320-354
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.04e-73
Family WD40-repeat 0.0000765
Further Details:      
 
Domain Number 2 Region: 202-471
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 1.18e-20
Family Quinohemoprotein amine dehydrogenase B chain 0.064
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00182.6|PACid:22025499
Domain Number - Region: 646-718
Classification Level Classification E-value
Superfamily TPR-like 0.055
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00182.6|PACid:22025499
Sequence length 894
Sequence
MPLRLEIKRKLAQRSERVKSVDLHPTEPWLLASLYSGTVCIFNYQTQTIAKSFEVTELPV
RSSKFIARKQWVVAGSDDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSASDD
MLIKLWDWEKGWMCTQIFEGHSHYVMHVTFNPKDTNTFASSSLDRTIKIWNLGSPDPNFT
LDAHSKGVNCVDYFTGGDRPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
LPIIITGSEDGTVRIWHATTYRVAIGYDEGTIMIKIGREVPVASMDSSGKIIWAKHNEIQ
TVNIKSVGADFEVTDGERLPLAVKELGSCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALA
WRNRSFGSGLEFVWSSDGEYAVRESTSRIKIFTKAFQEKKTIRPTFSAERIFGGTLLAMC
SNDFICFYDWAECRLIRRIDVNVKNLYWADSGDLVAIASDTSFYILKYSRDIVSSYLDSG
KPVDEEGVEDAFELLTETNERVRTGIWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMY
LLGYLANQSRVYLIDKEFNVMGYTLLLSLIEYKTLVIRGDVERANEILPSIPKDHHNSVA
HFLESRGMLEDALEVATDPNYRFDLAIQLGRLDVAKEIATEVHSESKWKQLGELAMSIGK
LEMAEECLQHAMDLSGLLLLYSSLGDAEGITKLASLAKDQGKNNVAFLCLFMLGKLEECL
HLLIESNRIPEAALMARSYLPSKVSEIVAIWRNDLNKINQKAAESLADPEEYPNLFEDWQ
VALAVESKTAEQRGTYPPAEEYPSCTEKSKINLVEAFKSMQIDEEEAPLENGDSSHEVVE
EDGVGEDRVEEDGEEEHQEETVEVDADSTDGGVLVNGSEGDEEYGMNHEGTPSA
Download sequence
Identical sequences A0A2G5DGB5
Aquca_020_00182.6|PACid:22025499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]