SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00203.2|PACid:22025573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00203.2|PACid:22025573
Domain Number 1 Region: 574-865
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.64e-65
Family WD40-repeat 0.0000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00203.2|PACid:22025573
Sequence length 865
Sequence
MSQTNWEADKMLDVYIHDYLVKRNLQASAKAFQAEGKVSPDPVAIDAPGGFLYEWWSVFW
DIFIARTNEKHSEVAASYIETQLIKAREQQLPQQQQQQQQLPQQHQQQQQQMQMQQLLLQ
RHAQQQQQQQQQQQRREGSHLLNGTANGLVSDGSHMRQNPGTANALATKMYEDRLKVPHQ
RDSMDDGALKQRFGENAGQLIDTNHSSMLKASATAGQTAGQVLHGTAGIPGTLQQVQARN
QQLPGSTQDIKSEINPVMNPRAAGPDGSLIGVPGSNQGGSNLTLKGWPLKGLDQLRSGFL
QQQKPFIQSPQPFHQLQMLSPQQRQLLLQAQNMNSPSASDVDSRRLRMLLNNQGLGKDGQ
MNLVGDVVSNVGSPMQAACPILPRGDTDMLIKKIAQLQQNSNQQQQQQLQQHGLSSQQSQ
NSNHHIHPQEKAAGAGSITADGSMSNSFRGNDQASKSQNGRKRKQHVSSSGPANSSGTAN
TAGPSPSSPSTPSTHTPGDVISMPTLPHNGSSSRALTVLGDGTGTLTSPSNQLWDDKDLD
GSLDDNIESFIAPDDNDPRDMIGRGMDVSKGFTFNEVGMFRASANKVVCCHFSSDGKLLA
TGGHDKKAMLWHTDSRRQKSALEEHSLLITDVRFSPSMPRLATSSFDKTVRVWDADNPGY
SLRTFTGHNSSVMSLDFHPINEDLICSCDGDSEIRYWSINNGSCTRVFKQGGTTQMRFQP
HLGRYLAAASDTIVSILDVETQACRHSLQGHTKAVHSVCWDPSGELLASVSEDSVRVWTF
GSGSEGECVHELSCNGNKFHSCVFHPAYPSLLVIGCYQSLELWNMAESKTMTLPAHEGLI
AALAVSNVTGLVASASHDKFVKLWK
Download sequence
Identical sequences A0A2G5DGF6
Aquca_020_00203.2|PACid:22025573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]