SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00230.1|PACid:22024883 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00230.1|PACid:22024883
Domain Number 1 Region: 335-629
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-77
Family WD40-repeat 0.0000506
Further Details:      
 
Domain Number 2 Region: 48-190
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 2.62e-49
Family Taf5 N-terminal domain-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00230.1|PACid:22024883
Sequence length 668
Sequence
MEEDDVEKAVMAYLKKKGFKATELALQEEQSRNSSSSASKTDPDIAKQILSFAESENGPT
RYHDGYSKLRSWTYSSLDLYKHELLRVLYPVFIHCFMDLVAKGYSQEARTFFNSFREDHE
LMHLRDLQKLEGVLCPSHLEEMEFAHSLRQSKVNIKICQYSYELLLQYLHKTQSITMLGI
INEHINFQVSPGQPSSISDDADAVILVGSSQDAAKQINEKEIHWGLLEDSVEDRLEKAGA
LMSDSEKIEGEKEVDLDENKKRSVDGGKQGSSVKKLKKDKIVGTTGKNVRSETNTVSMAP
RVKPELTLPVLSTEVEHSILEDLRNRVQLGSAALPSVCFYTFLNTHNGLNCSSISHDGSL
VAGGFSDSSLKVWDMAKIGQSTVQGENGTPTEQLSGSENGRRSYTLLQGHAGPVYSATFS
PLGDFILSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPMGHYFASCSHDRTARIW
SMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMV
LSLAMSPDGRYMASGDEDGTIMMWDLSSGRCITPLMGHTSCVWTLDFSGEGSLLASGSAD
CTVKLWDVTSSTKALKLDEKAGTTNRLRSLKALPTKSSPVYSVRCFGRSSLEGIFCLLLE
CSPKVHDR
Download sequence
Identical sequences A0A2G5DGM5
Aquca_020_00230.1|PACid:22024883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]