SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00230.3|PACid:22024885 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00230.3|PACid:22024885
Domain Number 1 Region: 335-655
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.97e-79
Family WD40-repeat 0.0000387
Further Details:      
 
Domain Number 2 Region: 48-190
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 2.62e-49
Family Taf5 N-terminal domain-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00230.3|PACid:22024885
Sequence length 661
Sequence
MEEDDVEKAVMAYLKKKGFKATELALQEEQSRNSSSSASKTDPDIAKQILSFAESENGPT
RYHDGYSKLRSWTYSSLDLYKHELLRVLYPVFIHCFMDLVAKGYSQEARTFFNSFREDHE
LMHLRDLQKLEGVLCPSHLEEMEFAHSLRQSKVNIKICQYSYELLLQYLHKTQSITMLGI
INEHINFQVSPGQPSSISDDADAVILVGSSQDAAKQINEKEIHWGLLEDSVEDRLEKAGA
LMSDSEKIEGEKEVDLDENKKRSVDGGKQGSSVKKLKKDKIVGTTGKNVRSETNTVSMAP
RVKPELTLPVLSTEVEHSILEDLRNRVQLGSAALPSVCFYTFLNTHNGLNCSSISHDGSL
VAGGFSDSSLKVWDMAKIGQSTVQGENGTPTEQLSGSENGRRSYTLLQGHAGPVYSATFS
PLGDFILSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPMGHYFASCSHDRTARIW
SMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMV
LSLAMSPDGRYMASGDEDGTIMMWDLSSGRCITPLMGHTSCVWTLDFSGEGSLLASGSAD
CTVKLWDVTSSTKALKLDEKAGTTNRLRSLKALPTKSSPVYSVRFSRRNLLFAAGVLSKS
S
Download sequence
Identical sequences A0A2G5DGI8
Aquca_020_00230.2|PACid:22024884 Aquca_020_00230.3|PACid:22024885 Aquca_020_00230.4|PACid:22024886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]