SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00230.5|PACid:22024887 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00230.5|PACid:22024887
Domain Number 1 Region: 334-654
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-79
Family WD40-repeat 0.0000387
Further Details:      
 
Domain Number 2 Region: 48-190
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 2.62e-49
Family Taf5 N-terminal domain-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00230.5|PACid:22024887
Sequence length 660
Sequence
MEEDDVEKAVMAYLKKKGFKATELALQEEQSRNSSSSASKTDPDIAKQILSFAESENGPT
RYHDGYSKLRSWTYSSLDLYKHELLRVLYPVFIHCFMDLVAKGYSQEARTFFNSFREDHE
LMHLRDLQKLEGVLCPSHLEEMEFAHSLRQSKVNIKICQYSYELLLQYLHKTQSITMLGI
INEHINFQVSPGQPSSISDDADAVILVGSSQDAAKQINEKEIHWGLLEDSVEDRLEKAGA
LMSDSEKIEGEKEVDLDENKRSVDGGKQGSSVKKLKKDKIVGTTGKNVRSETNTVSMAPR
VKPELTLPVLSTEVEHSILEDLRNRVQLGSAALPSVCFYTFLNTHNGLNCSSISHDGSLV
AGGFSDSSLKVWDMAKIGQSTVQGENGTPTEQLSGSENGRRSYTLLQGHAGPVYSATFSP
LGDFILSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPMGHYFASCSHDRTARIWS
MDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMVL
SLAMSPDGRYMASGDEDGTIMMWDLSSGRCITPLMGHTSCVWTLDFSGEGSLLASGSADC
TVKLWDVTSSTKALKLDEKAGTTNRLRSLKALPTKSSPVYSVRFSRRNLLFAAGVLSKSS
Download sequence
Identical sequences A0A2G5DGK3
Aquca_020_00230.5|PACid:22024887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]