SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00357.2|PACid:22024891 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_020_00357.2|PACid:22024891
Domain Number - Region: 156-227
Classification Level Classification E-value
Superfamily Caspase-like 0.0802
Family Caspase catalytic domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00357.2|PACid:22024891
Sequence length 395
Sequence
MIQYIVGVSLLLVSLIITVESRELADDVLKLPSQVSQFIHGDEKKDVDSVGTRWAVLIAG
SSGYWNYRHQADVCHAYQIMKKGGLKDENIIIFMYDDIAFNEENPRQGVIINNPRGEDVY
AGVPKDYTGDQVTVGNFLAVLLGNKTALTGGSGKVVDSGPDDRIFVYYTDHGGPGVLGMP
NNPYLYADDLIDTLKQKHASGTYKSLVFYLEACESGSIFEGLLPKGLNIYATTASNAEES
SWGTYCPGEYPSPPPEYETCLGDLYSIAWMEDSDIHNLQTETLKQQYHLVKDRTINQNTA
YGSHVMQYGDTDLNKEQLFLYIGSNPANDNFSFIEENRLPSSSRAVNQRDADLLHFWHKA
SYRPECETCWKAFIRNRERSRSVESCPASGAASCG
Download sequence
Identical sequences A0A2G5DH66
Aquca_020_00357.2|PACid:22024891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]