SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00385.1|PACid:22025386 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00385.1|PACid:22025386
Domain Number 1 Region: 119-219
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.41e-31
Family Ribosomal protein L19 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00385.1|PACid:22025386
Sequence length 226
Sequence
MQAVLRNLRVVEGFRNRISFSSLTSQTKIGYKIDSLASNNNGVSSLSLICKTPDSELFKL
GLFRPCLFTRYITTTGQSAESISQDASASIPDIAPRIKFKRLDKTARHIMQILDKEAVQE
VKEQREVAKQITDIKPGYIVQLKVEVPENKRRVSNLKGIVIARRNAGLNSTFRIRRLVAG
VGVESVFPLYSPNIKEIKILEKKRVRRAKLYYLRDKMNALKKQTSR
Download sequence
Identical sequences A0A2G5DHC1
Aquca_020_00385.1|PACid:22025386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]