SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00435.1|PACid:22025376 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00435.1|PACid:22025376
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-42
Family Ran-binding domain 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00435.1|PACid:22025376
Sequence length 230
Sequence
MADPENNPEHNNEEGAANEDEDTGAQIAPIVKLEEVAVTTGEESEDVLLDLKAKLYRFDK
EGNQWKERGVGTVKLLKHKESGKVRLVMRQSKTLKICANHFVIPTTSVQEHAGNEKSCVW
HATDYSDGELKEELFCIRFASIENCKAFKEMVQEVAESQGDKAESKEATSTADLLEKLTV
GETKEEEKAKEEVPSEEKEEVPSEEKKEKEEEKKEENKVDDQQAKSDGDK
Download sequence
Identical sequences A0A2G5DHG9
Aquca_020_00435.1|PACid:22025376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]