SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00486.2|PACid:22024839 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_020_00486.2|PACid:22024839
Domain Number - Region: 111-208
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00486.2|PACid:22024839
Sequence length 276
Sequence
MAGRHRMPRHGIDNGRRGYPPESPYARPMPRPPHPALLEEELEMQHAEFRRLLSDNRRLV
EDRMGLQQELGAAKEELHRMNIAITDIRADKEAHTRELIEKGLKLEADLRAAEPLRNEAI
QLRAEVQKLNTARQDLNGQVQKLTQELSRAQADNKQIPLMKAEIDGLHQELMRARSAFEY
EKKANVELMEQREAMQKNLVTMAREVEKLRADLASSDGRPWGPGGPYGIKLSSPEGGYPA
YGDAYGLPTGISDKGPLYGMSSAQWGGLEKPRLGRR
Download sequence
Identical sequences A0A2G5DIK9
Aquca_020_00486.1|PACid:22024840 Aquca_020_00486.2|PACid:22024839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]