SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00545.3|PACid:22025037 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_020_00545.3|PACid:22025037
Domain Number - Region: 115-175
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0248
Family PspA lactotransferrin-binding region 0.011
Further Details:      
 
Domain Number - Region: 155-249
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00545.3|PACid:22025037
Sequence length 253
Sequence
MFSQKLKNIIRLPFATIAYGTALMLLVMVWKPHFSILSLSALLRIIMTAEVLCAGSIMSI
YIGCVHQYNALNSQPDVLKSLYSALQPSSDLEELRYHDGGRLSDQQMALLQYQRENIHYL
SEEILRLQECLSKYERSDDGSTPQVDLAHLLAARDQELRALSAEMNQVQSELRLARNLIA
ERDSEFQRIRTTNNQYIEENERLRAILAEWSARAAKLERALEAEKFSSLELQKKISKLRN
QTSESIESHEINI
Download sequence
Identical sequences A0A2G5DIW8
Aquca_020_00545.3|PACid:22025037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]