SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00546.1|PACid:22025370 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00546.1|PACid:22025370
Domain Number 1 Region: 159-360
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000576
Family Cyclin A/CDK2-associated p19, Skp2 0.081
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00546.1|PACid:22025370
Domain Number - Region: 649-714,775-828
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000353
Family ATP-binding domain of peptide synthetases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00546.1|PACid:22025370
Sequence length 872
Sequence
MASSRIETFEDFVKVHALLLTASGIPSSLHHQLFQKLSTDTFDGGNSFQVEPCEDGRQRR
LILISDSMLKDSQVFLIDHAWTFRLADARNQLQEIPGLAERMASLMCVDHDLAADSEEPD
ANSGDLHENGFQGTVFELLESEILRQGEKGAEGVLWLELDELDIDDSMLCSLDLSNKFPN
LIALSLCGNKLKDVETVVQEVTKLKTLRALWLNDNPVLHHSDSRMEDNVLQGVPSLEIYN
SSFTDNYGEWALGFCGGIHGKDSPGNFNPNIHPLENMTSLDLSDRGIHNLSIQTFSPFKM
GSVSYLNLRGNPLDQNSVEVLLKLLKEFSCLQALEVDIPGPLGRSALEILEALPNLSLLN
GVMASKVLETKMHVIDTMLQPRLPELDPNESLADRVISAMWLYLMTYRLADEEKIDETSV
WYVMDELGSALRHSDAPNFRVSPFLYIPDGNLASAVSFSVLWPTENVNKGDECTRDFLFG
IGEEKQRSARLTAWFHTPQNYFIQEYEKYCKHLGLKTFASASPCTKASKTTSLNKQDGCI
LRVYTDIPQVEQFLTRPEFVLTNDPKEADIIWTCMQVDEDVKKTIGLTESQYINQFPFEA
CLVMKHHLAETVQKAQGFVKWFQTTYNLETHLSQLVGDYFVRRRDGLDNLWILKPWNMAR
TIDTTVTGDLSAIIRLMETGPKICQKYIERPALFKGKKFDLRYIVLVRSVNPLEIFLADV
FWVRLANNPYSLDKSTLFEYETHFTVMNYGRKLNHMNTPEFVMEFEMEHKVQWLDIHQRI
QKMIRTVFESAATVHPQMHSTTSRAMYGVDVMLDCSFQPKLLEVTYCPDCGRACKYDTKV
VVGSGETVKGQDFFNDVFGCLFLDETTHVTPL
Download sequence
Identical sequences A0A2G5DI23
Aquca_020_00546.1|PACid:22025370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]