SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00006.1|PACid:22039646 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00006.1|PACid:22039646
Domain Number 1 Region: 66-133
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0000000000249
Family Ribosomal protein L29 (L29p) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00006.1|PACid:22039646
Sequence length 150
Sequence
IFGDQDVYDESFSKKTISAATSETSNAAAAASSSSTTKLMHNPLEAFFESDRTQEEGNPV
VYGRSWKASELRLKSWDDLQKLWYVLLKEKNMLMTQRQMLHAQNLRFPNPERVPKVRKSM
CRIKHVLTERAIEEPDPRRSAEMKKMINAL
Download sequence
Identical sequences A0A2G5DEC2
Aquca_021_00006.1|PACid:22039646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]