SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00009.1|PACid:22039448 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_021_00009.1|PACid:22039448
Domain Number - Region: 196-270
Classification Level Classification E-value
Superfamily PH domain-like 0.00172
Family GRAM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00009.1|PACid:22039448
Sequence length 311
Sequence
MNTKPEESTHSPLTPPSTSIPPTQHQDQNTVPIEKISSSSSPSSTSIPPTQHQDQNTVPI
ENFSSSPSSTSIPPTQHQDQNTVPSSTTTTTQDPKTEKWGTHIMGPPAAPSSHPNNQKAA
ALWTAEEHNEPQHPYVQYSLNVSVVSGCYFAVKTGSSVSEAVYGKVGLTTKVLTGGGFES
LYKQTFNVIDPNEKLKKTFACYLSTSTGPVAGTLYLTNIHVAFCSDRPLSFPAPSGQVAW
SYYKVMIPLAKISSINPINMKDNPPERYIQIATVDNHDFWFMGFVNYDKASLHLSQSISG
SGFVTDTAHPI
Download sequence
Identical sequences A0A2G5DEH3
Aquca_021_00009.1|PACid:22039448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]