SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00040.1|PACid:22039573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00040.1|PACid:22039573
Domain Number 1 Region: 455-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 79-137
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000406
Family alpha-D-mannose-specific plant lectins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00040.1|PACid:22039573
Sequence length 796
Sequence
MNTKSNNSLLLFYGIVFLSCNTNLSIGANNITLGQSLSGNQTIISKGGIFELGFFKQGNT
TSDKYYIGIWYKKPSIQTAVWVANRDPVKDPNYSELKFSQDGRLVLLDERGYQQSFDYPT
DTWLPGAMLGLTKTRANGTFLTSQQNSDEPGTGNFLLNANTNISGPPVLRYMYVRNYYSR
WTYWTWSWNGHNFSLMNSSLSKYVNFSFVSSDEERYFTYSAHNTSIPIRLVMDFLGRLQL
FTWMEDLERWDSIFAHQTYVDDSEKWHTVFTKEYDYCGINTWSTVPMSRGNNSMWRCTCL
KGFESAEVWLSVYSFFGCKRKKALQCHSKGNDAFYVMDNMRLQEIVMHTNDQSISECKMT
CLSACSCAAYTYSNSCSIWLGELFSLQKVAPNDNLGKTLYIRVARAEIKSSRAEKLTRIF
IIVAVVGFSTVLGLLVIIWNIRWKMMFSVTSGVGFLVSFKYRFLQRATKNFSEELGKGGF
GSVFKGTMPDSSAVAVKRLVCSAGEKQFRSEVNTIGMIQHVNLIRLYGFCAEGRERLLVY
DYMPNGSLSSYLFRKNSKVLDWKTRYQIALGTARGLAYLHEKCRDCIIHCDIKPENILLD
AGLNAKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVPITPKADVYSYGMMLFEV
ISGRRNLDMGNDDMVDYFPAWAAKVTNKGEEVHSLLDQRLQGNADIKELTTASRVACWCI
QDDEKDRPSMGEIIQVLEGVSEVPTSPIPSFLQVILHRSTRTKYSTLSSSGVGSNNSVLL
QDENTNSWTSTISKDS
Download sequence
Identical sequences A0A2G5DEI8
Aquca_021_00040.1|PACid:22039573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]