SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00063.1|PACid:22039502 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00063.1|PACid:22039502
Domain Number 1 Region: 115-310,361-382
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.6e-49
Family Pseudouridine synthase RsuA/RluD 0.00047
Further Details:      
 
Weak hits

Sequence:  Aquca_021_00063.1|PACid:22039502
Domain Number - Region: 82-123
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00283
Family Pseudouridine synthase RsuA N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00063.1|PACid:22039502
Sequence length 385
Sequence
MKRKRGDCSSSGTANNKSMEIVWQSPANPPERHDYIFHDGRRHVRPYYFEFISHVKNRWA
GKTIVDLFAQEFKGRPYDYYVDAVKSGRIQVNGEIVPVSYIVKSSQKISHFLHRHEPPVM
AWDISILHKETDVVTICKPASVPVHPCGQYRKNTVVGILQAEHGLAPLFPVHRLDRLVSG
LLILARNAAKADLFRQQIEGGMVQKRYIAKVIGVFPEEEQVVNANVDYNAREGRSSTEEE
NCPGDRLSKGKSACTKFTRISTNGTYSIVLCEPITGRTHQIRVHLRYTGHPIANDTLYLD
DIVVTRSTEEVSTNEADKVNIDHSVKDDSDESSSFDFSIDPMCTNCPNLAPKGYGGHEEG
LWLHCVRYSGPGWVYECPYPDWAIL
Download sequence
Identical sequences A0A2G5DFH0
Aquca_021_00063.1|PACid:22039502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]