SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00082.1|PACid:22039565 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00082.1|PACid:22039565
Domain Number 1 Region: 18-103
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000615
Family GRAM domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00082.1|PACid:22039565
Sequence length 178
Sequence
MDTYYSLIDKAHGGRVKAKGTIYLSNIRMVFVANKPVGSFVAFDMPLLYVHGEKFNQPIF
HCNNISGLVEPVVPEGQHSALYSTQSFKILFKEGGCGTFVPLFFNLISSVRQYQQSSYPT
EAAPRADPLQAAQTPVDEMMRHAYVDPNDPTKIFLQQPTGESQLRRRTYQPQTADQSI
Download sequence
Identical sequences A0A2G5DEN9
Aquca_021_00082.1|PACid:22039565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]