SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00170.1|PACid:22039519 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00170.1|PACid:22039519
Domain Number 1 Region: 221-254
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000239
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00170.1|PACid:22039519
Sequence length 258
Sequence
MNATGLGFLSFPSQGLSSFTTHFSKSSNLGLSFIFPRKEITDNAPCLTFRPVRPTVWSIR
CEGNRIGRRRRSTASEGIQKGNIPESSDSESSKSAGQEDIIALFRQIQFSIAKDGGSTKI
RKRRSNNHKERKTAESVLDVLRQSRKQIQEENKVVPKRHGVPNTKGETKDSSLPTDFMLT
RPPSKFVKKSPIRRPSTLEEDVDEVVSEESEAAIVSEEPQLHKIEEMKVSELKELAKSRG
IKGYSKLKKGELVELLKG
Download sequence
Identical sequences A0A2G5DF57
Aquca_021_00170.1|PACid:22039519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]