SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00197.2|PACid:22039428 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00197.2|PACid:22039428
Domain Number 1 Region: 98-135
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000334
Family B3 DNA binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00197.2|PACid:22039428
Sequence length 158
Sequence
MMIKSKKEKENEGINEGQMTLAQCFQSLQSSSEPLTPLSMVVLNKPETPSRSVPSFQQVV
LDKPAEAPLSYEQEQAFPNHDKVKLCAIQRAEEVQANLDPRFPSFVKSMLHSHVIKGFWM
RIPGQFCKATFQNMMLQLLWLMRIGKNLLLITSCIRLD
Download sequence
Identical sequences A0A2G5DF72
Aquca_021_00197.1|PACid:22039429 Aquca_021_00197.2|PACid:22039428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]