SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00197.3|PACid:22039430 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00197.3|PACid:22039430
Domain Number 1 Region: 75-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000235
Family B3 DNA binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00197.3|PACid:22039430
Sequence length 135
Sequence
MPTLITSILADCNKFEQVVLNKPETPSRSVPSFQQVVLDKPAEAPLSYEQEQAFPNHDKV
KLCAIQRAEEVQANLDPRFPSFVKSMLHSHVIKGFWMRIPGQFCKATFQNMMLQLLWLMR
IGKNLLLITSCIRLD
Download sequence
Identical sequences A0A2G5DF62
Aquca_021_00197.3|PACid:22039430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]