SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00221.1|PACid:22039551 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00221.1|PACid:22039551
Domain Number 1 Region: 71-165,193-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-29
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Weak hits

Sequence:  Aquca_021_00221.1|PACid:22039551
Domain Number - Region: 387-419
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000196
Family Pan module (APPLE domain) 0.033
Further Details:      
 
Domain Number - Region: 274-301
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0563
Family alpha-D-mannose-specific plant lectins 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00221.1|PACid:22039551
Sequence length 439
Sequence
MSTSTHSFMFSCIFIFITLSFVAQAIVPASETFKYINQGEFGEYLVEYGANYRVLSPYAF
PFQLCFYNTTPNAFILSVRMGNRHSESIMRWVWDANRGNPVRENATLTFGTDGNLVLADA
NGRVAWQTGTANKGVVGLKLVSNGNLVLQDNRGRFVWQSFDYPTDTLLVGQALRLSGPSK
FVSRVSDVDGSEGPYSFVLDKNRIALYLKSKNSAKPLLYYIAYDFPPKQGINAVVFNSEP
VNEGFASELGYDLYVGNSSVASIFVGRPKYNSTLSMLRLESDGNLKVYTYNDKVDWGAWE
VTYSAFDKDGVYGVSECKLPSRCGSLGVCEDSQCVACPRPQGLLGWSKDCAPPRLPPCKG
GSQFVDYYKVVGVEHFTRDYTQGDGPMKLGDCKEKCSKDCGCLGFFYREQSSKCLLAPEL
GTLTKVSNQTHVAYIKMSK
Download sequence
Identical sequences A0A2G5DFA2
Aquca_021_00221.1|PACid:22039551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]