SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00222.1|PACid:22039525 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00222.1|PACid:22039525
Domain Number 1 Region: 72-166,195-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-29
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  Aquca_021_00222.1|PACid:22039525
Domain Number - Region: 390-422
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000745
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00222.1|PACid:22039525
Sequence length 438
Sequence
MTTSPSHSFSFSLIFLFITLAIVAQAAVPAANTFRYVNDGPLGEYIVEYFADYHVTPIFT
FPSTVCFYNTTPNAYTLAIRMGVRQSESIMRWVWDANRGNPVREGAMLTFGTNGNLVLAD
VDGRIAWQTDTANKGVVGLSLLPTGNLVLYDSRNRFVWQSFDYPTDTLLVGQVLRQAGPN
NKLVSRVSNKDGSKGAYSFILEKKRMALYMKSKNSPNPLPYYKYFEFGPQQTITSIVFDS
QPEYDTAYAYEIRFELFEGNVSAGTSIVARPKYNSTYSMLRVGSDGSFKAYTYYDKVDWG
AWEITYSLFDLDYVYGVSECKLPTTCGSLGVCEDSQCVACPTPKGLLGYSKTCAPPTLPP
CKNGVNSKKYYKVVGVEHFMNEYNDGEGPLDVSECRKKCNNDCGCLGFFYKEESSKCLIA
PELGTLTKVVNSSHMRSD
Download sequence
Identical sequences A0A2G5DG44
Aquca_021_00222.1|PACid:22039525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]