SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00223.1|PACid:22039738 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00223.1|PACid:22039738
Domain Number 1 Region: 94-171,199-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.81e-28
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Weak hits

Sequence:  Aquca_021_00223.1|PACid:22039738
Domain Number - Region: 397-430
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000942
Family Pan module (APPLE domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00223.1|PACid:22039738
Sequence length 456
Sequence
MSLSLSSSIPFIFLSIFIFSIVAKATVPASKTFKIINRGEITGDGFYAPNEYNAWYRYAG
LRTIPFMLCFYNTTPNAFTLGLRMAQQPSDNPINFRWVWDANRGKPVRENAALTFGADGN
LVLSEANGRIVWQTGTPNKGVVGLQLLPNGNLVLHDKQGKFIWQSFDHPTDTLLVGQGLR
PNGPTKLVSRVSDVDGSEGPYSFVLEKQSLALYLKSKNSKSPLLYYSTDSENPPYRGSNP
TKSMVFDISPKTGSADAYELRYEFYNGDNDWTMLLARPKYNSTYSFLRLGSDGDIKIYTY
NDKVDWGAWEVTYSLFGNEGVISGDECKLPKKCGSLGLCDKNQCVACPRPKGLKGWSEGC
APPKLGHCKNGQANNFDYYKVVGVENFMSDYKQGEGPVSLTKCKEKCNRYCECLAIFYKE
ESSKCLLVPELGTLRKVSNQTHVAYIKTPKYAKVAI
Download sequence
Identical sequences A0A2G5DF97
Aquca_021_00223.1|PACid:22039738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]