SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00241.3|PACid:22039408 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00241.3|PACid:22039408
Domain Number 1 Region: 6-237
Classification Level Classification E-value
Superfamily 14-3-3 protein 9.68e-105
Family 14-3-3 protein 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00241.3|PACid:22039408
Sequence length 251
Sequence
MAFPKERETFVYVAKLAEQAERYDEMVESMKNVAKLDVELTVEERNLLSVGYKNVVGARR
ASWRILSSIEQKEEGKGNDQNAKRIKEYRHKVESELSSICNDIMTVIDEHLIPASTAGES
NVFYYKMKGDYFRYLAEFKTSNDRKEAADQSLKAYELASSAAEADLSPTHPIRLGLALNF
SVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE
DGGTSKVLRID
Download sequence
Identical sequences A0A2G5DG75
Aquca_021_00241.3|PACid:22039408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]