SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00110.1|PACid:22054823 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00110.1|PACid:22054823
Domain Number 1 Region: 201-430
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.48e-56
Family BC ATP-binding domain-like 0.000000779
Further Details:      
 
Domain Number 2 Region: 98-200
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.41e-30
Family BC N-terminal domain-like 0.00014
Further Details:      
 
Domain Number 3 Region: 434-533
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.26e-28
Family BC C-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00110.1|PACid:22054823
Sequence length 542
Sequence
MACIAFNTATFLRCSIEKPVLKSFNRDFSSVFFTLTHKLKTTNSLWCHGVIRESNGLRSS
FSLFKCFSQTSEQFNSGGGDGVGSSENNNESISEEKLVVLVIGGGGREHALCYALKRSPS
CDTVFCAPGNAGISKSGVATCIMDLDPLNSSAVISFCRKWGVGLVVVGPEVPLVKGLAND
LEKAGIPTFGPSAEAAALEGSKDFMKKLCYKICCNRLLMIPQYQTFTDATDAKKYIKEQG
APIVIKFDGLAAGKGVVVAMTLEEAYEAVDSMLVEKVFGSADSADSRVVIEEYLEGEEAS
FFAVVDGKNAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPIITEELKSLVMRSIILPTV
KGMSAEGCKFVGVLYAGLMIEKTTGAPKLIEYNVRFGDPECQVLMVRLESDLAQVLLAAC
RGELSGVSLKWSSGTSMVVVLASEGYPGDYKKAKGTVIRNLEKAENVAPSVKIFHAGTSV
DSDGNFIAVGGRVLGVTARGTDIEEARDRAYQAVDQIDWTEGFFRRDIGWRALPQKQLTN
KG
Download sequence
Identical sequences A0A2G5DD99
Aquca_022_00110.1|PACid:22054823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]