SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00110.2|PACid:22054824 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00110.2|PACid:22054824
Domain Number 1 Region: 201-426
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.75e-62
Family BC ATP-binding domain-like 0.000000511
Further Details:      
 
Domain Number 2 Region: 98-200
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.4e-30
Family BC N-terminal domain-like 0.00014
Further Details:      
 
Domain Number 3 Region: 430-529
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.26e-28
Family BC C-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00110.2|PACid:22054824
Sequence length 538
Sequence
MACIAFNTATFLRCSIEKPVLKSFNRDFSSVFFTLTHKLKTTNSLWCHGVIRESNGLRSS
FSLFKCFSQTSEQFNSGGGDGVGSSENNNESISEEKLVVLVIGGGGREHALCYALKRSPS
CDTVFCAPGNAGISKSGVATCIMDLDPLNSSAVISFCRKWGVGLVVVGPEVPLVKGLAND
LEKAGIPTFGPSAEAAALEGSKDFMKKLCYKYGIPTAKYQTFTDATDAKKYIKEQGAPIV
IKFDGLAAGKGVVVAMTLEEAYEAVDSMLVEKVFGSADSADSRVVIEEYLEGEEASFFAV
VDGKNAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPIITEELKSLVMRSIILPTVKGMS
AEGCKFVGVLYAGLMIEKTTGAPKLIEYNVRFGDPECQVLMVRLESDLAQVLLAACRGEL
SGVSLKWSSGTSMVVVLASEGYPGDYKKAKGTVIRNLEKAENVAPSVKIFHAGTSVDSDG
NFIAVGGRVLGVTARGTDIEEARDRAYQAVDQIDWTEGFFRRDIGWRALPQKQLTNKG
Download sequence
Identical sequences A0A2G5DDA7
Aquca_022_00110.2|PACid:22054824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]