SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00154.1|PACid:22054782 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00154.1|PACid:22054782
Domain Number 1 Region: 346-435
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 28-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-19
Family B3 DNA binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 197-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-16
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00154.1|PACid:22054782
Sequence length 441
Sequence
MKILKSSSFRQFPSRTTNRISKVIKKEQSRQPYFVKGMIGDFRNKLRIPMTFIKDFNGDV
PDQFKLRSLIGRSWIVSVKQVNDDFFLCNEWKAFAKDNSLEFGEFIICIQNGNSDFTVKI
CSKNSCNKKVCLAKKNNVESISCFREEKQHKETAKIAKLPPQNDKESVVDHMNSGSCMPD
TQIVKTERSKALIGGDSFIAHLVSSNIYRMGIPRWLATKCFMEKDSTMLLNPCGMAWPVK
IAHEKDGRTCLSAGWREFFRSNDLSTDDTCCFEVIKDMDNAIRVEILQKGVKGQASAAMA
SSKEVNEASRTKRKKENVTDHLPSKREADQLRDTETISTTASTSIFPSCSVSLLPSYVNR
SSYLNVPMLFAKTYLKDAHSVILRTPNGGFWRVRFKEPCRMGKGWKEFVVANHLKEGDVC
KFELVDSNHMELMVSISPAKA
Download sequence
Identical sequences A0A2G5DDC5
Aquca_022_00154.1|PACid:22054782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]