SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00246.1|PACid:22054925 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00246.1|PACid:22054925
Domain Number 1 Region: 114-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-49
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 701-780
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000255
Family PB1 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00246.1|PACid:22054925
Sequence length 836
Sequence
MSTQMRISSSGFSNQTQEGRCMNSELWHACAGPLVSLPSVGSHVVYFPQGHSEQVTASTN
KEIDARIPNYPSLPPQLICQLHDVTMHADVETDEVYAQMTLQPLSQQEQKDVYLPAELGV
PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGTEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLHLGIRHANRPQTMMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRATPSEFVIPLTKYAKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITGISDLDPVRWPNSNWCSVKVGWDESTAGERQPRVSLWEIEP
LTTFPMYPSQFSLGLKRPWPPGLPSLHGGKGDDLSINSPLMWLQGGGANRGIESLNFQGV
GVNPWVQTRLDASLLGLQSDMYHSMAASALQEMRTMGSSQQAPPSLPQVQLSPNLPGSAL
MMRQMVQQSQPQSAFLQNIHENQSHNLGYGQAPFHLLQTQLQEQKPQQQQELPSQQQIPD
IVSALAHYASASQSQSPMQNLSSLCQKQSFPESNANLVASTGVSPLYNSLGSISQEETTN
LLDLPRSNAVISSDGWLPRQVGFESLLPSGVNQYLMPQVEQFGQQQTNISPQNVPLSPLP
QREYSEDQEGTNFPLHSNMATSSCLDESSFLQSPENEGQVNQPIRTFVKVYKSGSFGRSL
DITKFSGYQELRSELECMFGLTGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVW
CIKILSPQEVQKMGKQGLELLNPRQRLSGGSYNSYVNCEDSRNLSPRSTSVSSLNY
Download sequence
Identical sequences A0A2G5DDT0
Aquca_022_00246.1|PACid:22054925 Aquca_022_00246.2|PACid:22054924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]