SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00248.1|PACid:22054809 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_022_00248.1|PACid:22054809
Domain Number - Region: 111-177
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00248.1|PACid:22054809
Sequence length 290
Sequence
MNHDRSFSSPELIPHGSHAEHSNDSTLEGVSTNIKLLLKIIQDHNNASPRDDDGRRMQRV
AGMLTILDDVKHRIQKSQSFGKKKEIEFRRCYTDLRPNRIPKDKKPPEPLDEKQKLLKEL
NDSLAARKSLERMFSSLGKEKAIMSAELAKKAQELNSLEEQLNDLREQNAMLMEKVQTCA
SKHKKVSGDSQGNATLQERNKALSEQLLKSLDGYRSAKRKMKEAQEENATFRAKMGEMAE
EIVAGLNRLHAFQQQIAEKNEDVDMEEELSALEHMLQGIETKISSDEPKE
Download sequence
Identical sequences A0A2G5DEM7
Aquca_022_00248.1|PACid:22054809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]