SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00250.3|PACid:22055059 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00250.3|PACid:22055059
Domain Number 1 Region: 416-662,701-789
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000157
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00250.3|PACid:22055059
Sequence length 816
Sequence
MSSWNYVVTAHKPTSVSHSCVGNFTGPQELNLIIAKCTRIEIHLLTPQGLQPMLDVPIYG
RIATLELFRPYGEAQDLLFIATDKYRICVLQWDAETSEIITKSNGDVADRIGRPTDNGQL
GMIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLYGCSKPTIVVL
YQDNKDARHVKTYEVALKEKDFVEGPWSQNNLDNGAGLVIPVPRPLGGVIIIGEETIVYC
SATAFKAIPIRPSITRAYGRVDADGSRYLLSDHTGLLHLLVITHERERVTGLKIELLGET
SIASTISYLDNAFVFVGSNYGDSQLIKLNLQPDAKGSYVEVLERYVNLGPIVDFCVVDLE
RQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLRSSTDDPFDTFLVVS
FISETRILAMNPDDELEETEIEGFDSQVQTLCCHDAIHNQLLQVTASSVRLVSSTSRELR
NEWKAPSGFSVNVATANATQVLLATGGGHLVFLEVGDGILTEVKHAQLEYEVSCLDINPI
GENSNASQLAAVGMWTDMSVRIFSLPGLDLITKEHLGGEIIPRSVLLCAFEGVSYLLCAL
GDGHLFNFLLNLSSGELSDRKKVSLGTQPITLRTFSSKNTTHVFAASDRPTVIYSSNKKL
LYSNVNLKEVSHMCPFNSAAFPDSLAIAKEGELTIGTIDDIQKLHIRTIPLGEHARRICH
QEQSRTFAICSLKYCQSNAEESEMHFVRLLDDQTFDFISTYPLDTYEYGCCILSCSFADD
SNTYYCVGTAYVLPEESEPTKVRVFCLLSSFESQKC
Download sequence
Identical sequences A0A2G5DDT5
Aquca_022_00250.3|PACid:22055059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]