SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00323.1|PACid:22055022 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00323.1|PACid:22055022
Domain Number 1 Region: 431-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-76
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 24-136
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-19
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Weak hits

Sequence:  Aquca_022_00323.1|PACid:22055022
Domain Number - Region: 293-319
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0863
Family Pan module (APPLE domain) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00323.1|PACid:22055022
Sequence length 729
Sequence
MKRDVQSYQLPAITANCFQDKEPPQVLWSANRNKPVKDDGTLEFNSQGDLVLRDGDGTLV
WSTNTSGKLVVGMRITATGSLLLYDANNMTVWKIGTWAKMTANASPSNWAPGVFYLSVTD
GGLCAFIDSNPPQRYRKYFTRDRSISPKNVSRSIRFKNGSLNFTDGKAGSPISVDYIPDG
RNEFQYMRLDTYGHLRLYQWAPARESVVDDIFNIDYSNCSYPTVCGSYGICSDGQCTCPV
ERGGDQSYFKPYDYRQLNLGCQETTQLSCNSSEVHLIEIADVTYIGFAEIMVNIYIENCK
QACLNNCSCKAALFRSYEDVSVGDCSLPSQIFSLMGSSEYNLDYNPTTFLKVQSASIAIN
PSSPTGRGNNQDKNNARRYAIMFGSIFGTVFVVVLIISLYVYVIRKRINKEQEAKEYDLS
DEFDDHLDESSEMPKRFSYDELKSATGNFHRKIGRGGFGSVYEGILGHGIIAVKCLDFGQ
GQGRKQFLAEVRTIGSIHHVNLVKLVGFCAENSHKLLAYEYMCNGSLDKWIFHEESTLDW
KTRRKIILDIARGLSYLHEECRKRIILLDIKPQNILLDGDFNAKVSDFGLARFVEKDESQ
VLTMLRGTRGYLAPEWLLNRRISEKVDVYSFGVVVLETMCGRRNLDYSQPEENECLLHLI
RRKAEEDQLIDVVDNQNEDMQEHREEAVKMIRIAIWCLQGDYTRRPSMSTVVKVLEGVMD
VENISDYSF
Download sequence
Identical sequences A0A2G5DE67
Aquca_022_00323.1|PACid:22055022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]