SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_023_00040.1|PACid:22023140 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_023_00040.1|PACid:22023140
Domain Number 1 Region: 472-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-74
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 75-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-22
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  Aquca_023_00040.1|PACid:22023140
Domain Number - Region: 153-256
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00791
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_023_00040.1|PACid:22023140
Sequence length 829
Sequence
MLINFSISLSTFFFLIHFLLFPISYANIPLGSTLTPVSTSINNSINWTSPNNTYSLSFIP
IASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGV
TTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTL
RWNNSIMYWNEALNSSFIGNLSSPSLRFQQIGIIQLSGPTLSVPVNMAYSSDYGEGTDIF
RYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSAPVCGCPSQ
NFEFLDPNDSRKGCKRKVEIADCPNNATMLQLEHTEFLIYPPETSSQLYRIGISACRENC
LVGASCVASTSLADGTGQCYLIGTDFVSGSQSPALPSSSFIKVCSPELPNRSSSTMNPNQ
RSSKKLPAWVFAVVVVITLVALVLLQFGLWLWCCKNSPRYGGLSVQYALLEYASGAPVQF
SYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISST
HHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARG
ITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGY
LAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNS
IVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSRT
EGSVGGTSIWNASSGISALSTFAPSAQAPSFSSSTMQMGAISSVSSKGS
Download sequence
Identical sequences A0A2G5DCP1
Aquca_023_00040.1|PACid:22023140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]