SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_023_00191.2|PACid:22023265 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_023_00191.2|PACid:22023265
Domain Number 1 Region: 78-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-31
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 2 Region: 495-620
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-30
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 3 Region: 354-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000102
Family Hairpin loop containing domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_023_00191.2|PACid:22023265
Sequence length 648
Sequence
MYSMRTSFSVILFVISLFFHRSGFCFALESISSNKLIRDSDSITSLNKTFRLGFFSPADS
SNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSA
NANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKND
SDPSQGRFRLELEPLNIAQLVIWEGSLCHWRSGPWDGTVFIGVEGMYADASNGFGLDRNE
EGVYLTVSYSNKTLHPRYALNSLGQISENFYNETENRWDQSWFMPKTECDFYGKCGCFGF
CNILSKPICSCLKGYEPSSSEEWNKGNWSGGCVKRKPLQCEQNNSSGDEVKEDGFFKYER
MKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMD
GADLYIRVAHSELDEKKNMVHAYIIIVVIGLSVIAFSMYILRRWAMKKKRMAQRRVLVLG
KNDSTKELLDTDKLDSEPSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAV
KRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFG
VLHTTYMWHHLYRTSWCHMSSSNGLSLDGTSYKVKANYYKDILSSLPH
Download sequence
Identical sequences A0A2G5DCF9
Aquca_023_00191.2|PACid:22023265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]