SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_023_00201.1|PACid:22023067 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_023_00201.1|PACid:22023067
Domain Number 1 Region: 307-518
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.84e-37
Family ABC transporter ATPase domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 23-250
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000575
Family DNA repair protein MutS, domain III 0.029
Further Details:      
 
Domain Number 3 Region: 743-815
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000235
Family Smr domain 0.005
Further Details:      
 
Weak hits

Sequence:  Aquca_023_00201.1|PACid:22023067
Domain Number - Region: 530-615
Classification Level Classification E-value
Superfamily t-snare proteins 0.0118
Family t-snare proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_023_00201.1|PACid:22023067
Sequence length 816
Sequence
EESQKFLNQTTAAILLPQPLDFSGIEDIRGIVNSSVSGEIRSVRELCAVMRTLRSARAVF
QQLKKVSDDEGSSDRYSSLLDILQNCDFLTELEHKIEFCIDCNLSVVLDRASEDLEIIRS
ERKRNMNMLESLLKKVSTQIFQAGGIDSPLVTSRRSRMCVAIRASHRSLLPDGIVLNASS
SGATYFMEPRDAVELNNMEVTLSNSVKAEELAVLSMLTSEIAESESEILYLLERILELDL
VSARAAYARWIDGVCPIIDQNFEGLESSKSESSLSVDIEGIRHPVFLESSLRSSSTPLSE
LDGGNGIMHSRNLSEGMYDFPVPIDIKIGRATKVVVISGPNTGGKTASMKTLGLASLMSK
AGLYLPAKATPKLPWFDLILADIGDHQSLEQNLSTFSGHISRICKILELGSNKSLVLIDE
IGSGTDPSEGVALSASILQYLKDRVNLAVVTTHYADLSCLKERDFRFENAAMEFSLETLQ
PTYRILWGCIGNSNALTIAKSIGFDNEVLDRAHKWVEKLMPDKQTERKGILYQSLTQERN
MLESQARQAGSLHSEIMKLYREIQDEAEDLDRREEALKAKETQKVKQELKAAKAQIDVII
QKFENQVKNANSDQFNTLTREAEAAIAAIVEAIRPSDIRVSSSYVPQVGEKVLVKGYGNK
LATIVEAPGDDGMALIQYGKLKVRVNKNRLNTLKATPKNQRNTETIPGLKGLAQSKKKAL
KDSFDVNNGVDAPFGPAVQTSKNTVDLRGMRVEQASHHLSMAISASRSKGVLFVIHGIGT
GVLKKRALELLKNHPRIAKIEDESPMNDGCTVAYIK
Download sequence
Identical sequences A0A2G5DCL1
Aquca_023_00201.1|PACid:22023067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]