SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_024_00015.1|PACid:22051432 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_024_00015.1|PACid:22051432
Domain Number 1 Region: 10-153
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.83e-30
Family Staphylococcal nuclease 0.0087
Further Details:      
 
Domain Number 2 Region: 583-717
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 9.42e-29
Family Staphylococcal nuclease 0.0012
Further Details:      
 
Domain Number 3 Region: 185-234,277-372
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 9.02e-26
Family Staphylococcal nuclease 0.0039
Further Details:      
 
Domain Number 4 Region: 379-460,509-563
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.88e-21
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 5 Region: 761-859
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-18
Family Tudor domain 0.0073
Further Details:      
 
Domain Number 6 Region: 821-976
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.97e-16
Family Staphylococcal nuclease 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_024_00015.1|PACid:22051432
Sequence length 991
Sequence
MAPASAAGTATPGWLRGKVKAVPSGDSLVIMALTKTGIPPPEKTITLSSVIAPRLGRRNG
FDEPFAWDSREYLRKLCIGKEVTFRVEYTVTSIGREFGSVFLGEKNVALLVISEGWAKVK
DREQHKEELHPYLAELLRLEEQAKERELGRWSKVPGAADASIRRLPPSTLGDPNNLDVVN
FLSENKARPIEGIVEHVRDGSTIRVYLLPEFQFVQVFVAGIQSPSMGRRAPVDAVAELEK
TANEPKVVESSESGLPLSSAQKLMSSIALSTEVEPDPFGREAKHFTEIRILHRDVRIVLE
GVDKYSNLIGSVYYPDEDMAKDLALELVENGLARYLDWSANMMEEEARRRLKGAELKAKK
DRLRMWTNFVPPTSDSKAVHNQNFSGKVVEVLSGDCVIIADDAVPFGSSLAERRVNLSSI
RSPKMGNPRRDEKPAAYAREAREFLRTRLIGRQVHVSLEYSRKVSVADGPIPTAGSAESR
IMNFGSVFLVSPSLTEGNETSPPYSENPQAGVNVAELVVSRGFGTVIRHRDFEERSNYYD
ALLAAESRAISGKKGIHSANDPPVMHITDLLMASAKQANKFLPFLQRSKRLPATVEYVLS
GHRFKLLIPKETCNIAFSLSGVRCPGRGEPYSDEAIAFMRRKILQRDVEIEVENVDRTGT
FLGSLWESKTNMAVTLLEAGLAKLQTAFVADRIPDFYLLAHAEKSAKKQKLKIWETYVEG
QENGNPSAGESKKKEVLKVVVTEVLGGGKFYVQMVGDQKMDSIQQKLASLDLQEAPVVGA
FNPKKGDIVLAQFSADNTWNRAMVVNAPQGAVSSEKDSFEVFYIDFGNQEIVPYCRLRPL
DASLSMAPGLAQLCTLAYIKVPNLEEDFGQEAAEYLSMCTLGSAGELQATIEERDNSGGK
VRGQETGPVLSVILSLVDAGSNINADMLEKGYARLGRRNRWDTKERHTALDQLEKHQAKA
KRERLAMWQYGDIQSDDEDNAPPSRKTGGRR
Download sequence
Identical sequences A0A2G5DAV0
Aquca_024_00015.1|PACid:22051432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]