SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_024_00029.1|PACid:22051487 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_024_00029.1|PACid:22051487
Domain Number 1 Region: 335-549
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.92e-36
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0029
Further Details:      
 
Domain Number 2 Region: 32-151
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.8e-21
Family FHA domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_024_00029.1|PACid:22051487
Sequence length 751
Sequence
MAKRQQAEKDLFDDNKRQRRTPPPITTKVGGLLYLRSIDTPFISSTTTTNLICLRSDRLY
TIGRKHCYCNLVFDDPRVSKRHCQIFFDACQHKFQETGDEEEEARVRVKPSLNGVFVNGL
RVGKGKVVELCIGDEVKFVCSNELDLNFGVKIGFVLERIVFSEDVRTCSFMANRVPRSLN
EKNELGKEKSISLSDDNHRISRRAGLLLNQCRQILRSEDPISYIRGCIDLKGEKEVLRSC
NSVEIRASMTVFDVQHDLLVANTSNVTKSCLVKSCREIGSSSGTILRKDCIQSSVQNTTG
ECSYNSLPSNVTKNVNQSNSVLSSNDDLEILRLPPGKKFYLNRLDFKDNRLFGQHMVVSL
PELLHPIQSICRMFIATFTSDISWFLSYCKVPNNLPVTIACHNTERCWSSSPDKRIWTPY
EDFPNLVLIYPPFPDVIAFGQDRKRHGIACHHPKLLVLQREDSIRVVVTSANLVSKQWND
VTNTVWWQDFPLKSLPDFSSLFTSTGEETFEGLKSDFAAQLAGFVAGLVVDLPSQAHWIT
ELTKYEFGGADGHLVASVPGMHRHKTPYTLEAMHFLSSSGSASRLNGMKFVGSVEASLVG
LKHRFHTTADSNGAALKTLATFLGNCQENAFGMSEVVLKRNHNIPADANAVSVLICNLDE
FSEGEYIQLGFLPRNTAKWVASLCDAGFFSFSAYIHPKEVLAAALEGSNNIVQLILGLAF
LKYQVCCKPNMLFPYAHLSHLCRGTRSIQVA
Download sequence
Identical sequences A0A2G5DB02
Aquca_024_00029.1|PACid:22051487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]