SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_024_00063.1|PACid:22051458 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_024_00063.1|PACid:22051458
Domain Number 1 Region: 28-115
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000504
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_024_00063.1|PACid:22051458
Sequence length 120
Sequence
MQILLISPKIFICGRGNHLNLHFVLISAVCSCGYDNVNANRVWRLFDARCGSVVSLWQAQ
DGYTQDDKKDHLLVFSSLDKTVRVWDLRNSSWSGPSQSYVFRCHSDGVAGLAVWDFNFQE
Download sequence
Identical sequences A0A2G5DB22
Aquca_024_00063.1|PACid:22051458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]