SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_024_00073.1|PACid:22051433 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_024_00073.1|PACid:22051433
Domain Number 1 Region: 62-166
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.75e-27
Family 2Fe-2S ferredoxin-related 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_024_00073.1|PACid:22051433
Sequence length 188
Sequence
MALKFSCNLSFRTSPTRIPSHFPQYLPVNHQNPARGSSCAARAELQTSIGLPEQNGSYTA
TTVPTHKVTVHDRERGVFHEFLVPEDQYILHTAEAQNISLPFACRHGCCTSCAVRVKSGQ
LRQPEALGISAELKAKGYALLCVGFPSSDLEVETQDEDEVYWLQFGRYFARGPIERDDYA
LELAMGDE
Download sequence
Identical sequences A0A2G5DB52
Aquca_024_00073.1|PACid:22051433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]