SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00261.1|PACid:22063132 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00261.1|PACid:22063132
Domain Number 1 Region: 124-170
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000000034
Family BSD domain 0.003
Further Details:      
 
Domain Number 2 Region: 9-104
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000984
Family TFIIH domain 0.0073
Further Details:      
 
Domain Number 3 Region: 202-253
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000051
Family BSD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00261.1|PACid:22063132
Sequence length 605
Sequence
MASRQVVMRAKYKNSVRDPGIQGVLIMMEDKISFTPDDPTSSVRVNIEVKSIKSLKFSKE
GSQRALLNLILDPDIKEGGCIFEFEKFSDRDVCRDFVSRVLAKLQALQSSVKDSKTVSER
PVDEQLSTAEMRHRMKLLQENIELQKLHKQFVISGVLTEAEFWATRKELLAVHASKTPKQ
RVGFKSAMIADVRPLTDGRSNLVTFNLTPEIIHQIFAEKPAVHKAYLSFVPRKMSEMDFW
KKYCRAEYLHKTKNAVAAAAEAADDEELAVFLKHDEILASEARRKLRRVDPTLDMEADQG
DDYMHLPDHGIFRDGSKETIDTEYDEYKRTLAQNLNRHAAVVLEGRALDVELGDTQTVAE
ALFRYKQSELATETSDENSTQERLERLSRMTEIEDLQDSHNLPFAPLCIKDPREYFDSQQ
ANAVKALGDTEIGTKPVNCVLSTQQAYGSLKIIISEIKENGFSYPIVKPDVALKVLNGLT
QHLSSTKHHLGKSPQDTVLDRLPQRTREELLHHWACIQELLKHFWSSYPITTKSLHTKVS
RVKDALSEIYPKLQGIKESAQSDFRHQVSLLVQPMLQALDAAFAHYDAEMQKRPGKSAER
PNGYA
Download sequence
Identical sequences A0A2G5DA71
Aquca_025_00261.1|PACid:22063132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]