SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00377.4|PACid:22063104 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00377.4|PACid:22063104
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 7.98e-29
Family Staphylococcal nuclease 0.01
Further Details:      
 
Domain Number 2 Region: 580-714
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 7.06e-28
Family Staphylococcal nuclease 0.0016
Further Details:      
 
Domain Number 3 Region: 180-229,272-367
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.09e-25
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 4 Region: 374-455,506-560
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.75e-22
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 5 Region: 772-856
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.63e-18
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00377.4|PACid:22063104
Sequence length 948
Sequence
MASAGAASGWLRGRVKAVPSGDCLVIMAVTKAEIPPEKTITLSSLVAPRLARRGGVDEPF
AWNSREYLRKLCIGKEVTFRVDYTVPSIGREFGSVFLGDKNVALLVVSEGWAKVREQGQQ
KGEVSPFLAELQSLEEQAKQQGSGRWSKVPGASEKAIRNLPPSAIGDPSNLDAMGLLAAN
KGRPMEAIVEQVRDGSTVRVYLLPEFQFVQVFVAGIQAPSMGRRGAVETVVEPEVMSDEL
NGEASAVPRAPLTSAQRLAASTASSTEVSPDPFGREAKHFTEIRVLHRDVRIVLEGVDKF
SNLVGSVYYPESDSAKDLALELVQNGMAKYLDWSANMMEEDARRKLKTADLQAKKDRLRI
WTNYIPPATNSKAIHDQNFTGKVVEVVSGDCIIVADDAVPYGSPLAERRVNLSSIRSPKM
GNPRRDEKPAPYAREAREFLRTRLIGRQVNVSMEYSRKVSMVDGPVPVAGSADSRVMDFG
SVFLVSPSKVEADDSTPSPSPSSSQTTGVNVAELVIGRGFGTVIRHRDFEERSNFYDALL
AAESRAIAGKKGIHSAKDPPVMHITDLLTASSKKAKDFLPFLQRSRRLPAVVEYVLSGHR
FKLLIPKETCTIAFSFSGVRCPGRDEPYSDEAISLMRRKILQRDVEVEVETVDRTGTFLG
SLWESKTNVAVSLLEAGLAKLQTAFGADRIADAHLLARAEQSAKQKKLKIWENYIEGQEA
ANGLVAETRQKEVLKVVVTEVLGGGKFYVQTVGDQKVASIQQQLASLSLQDAPVIGIFNP
KKGDIVLAQFSADNSWNRAMIVNAPRGVVESPKDIFEVFYIDYGNQEVVTYSQLRPLDPS
VSSAPGLAQLCTLAYVKIPSLEEDFGQEAAEFLSDRTLNSSRELRAMIEDRDASAGKVKG
QGTGTVLIITLVDVEAGSSINAAMLEVRTNMYLGESGLLSRKDLPRSL
Download sequence
Identical sequences A0A2G5DAR9
Aquca_025_00377.4|PACid:22063104 Aquca_025_00377.5|PACid:22063105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]