SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00377.9|PACid:22063109 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00377.9|PACid:22063109
Domain Number 1 Region: 507-641
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.67e-28
Family Staphylococcal nuclease 0.0016
Further Details:      
 
Domain Number 2 Region: 107-156,199-294
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.96e-25
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 3 Region: 301-382,433-487
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.36e-22
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 4 Region: 699-783
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.65e-18
Family Tudor domain 0.01
Further Details:      
 
Domain Number 5 Region: 745-900
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.02e-17
Family Staphylococcal nuclease 0.0076
Further Details:      
 
Domain Number 6 Region: 2-75
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000693
Family Staphylococcal nuclease 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00377.9|PACid:22063109
Sequence length 915
Sequence
MQEVTFRVDYTVPSIGREFGSVFLGDKNVALLVVSEGWAKVREQGQQKGEVSPFLAELQS
LEEQAKQQGSGRWSKVPGASEKAIRNLPPSAIGDPSNLDAMGLLAANKGRPMEAIVEQVR
DGSTVRVYLLPEFQFVQVFVAGIQAPSMGRRGAVETVVEPEVMSDELNGEASAVPRAPLT
SAQRLAASTASSTEVSPDPFGREAKHFTEIRVLHRDVRIVLEGVDKFSNLVGSVYYPESD
SAKDLALELVQNGMAKYLDWSANMMEEDARRKLKTADLQAKKDRLRIWTNYIPPATNSKA
IHDQNFTGKVVEVVSGDCIIVADDAVPYGSPLAERRVNLSSIRSPKMGNPRRDEKPAPYA
REAREFLRTRLIGRQVNVSMEYSRKVSMVDGPVPVAGSADSRVMDFGSVFLVSPSKVEAD
DSTPSPSPSSSQTTGVNVAELVIGRGFGTVIRHRDFEERSNFYDALLAAESRAIAGKKGI
HSAKDPPVMHITDLLTASSKKAKDFLPFLQRSRRLPAVVEYVLSGHRFKLLIPKETCTIA
FSFSGVRCPGRDEPYSDEAISLMRRKILQRDVEVEVETVDRTGTFLGSLWESKTNVAVSL
LEAGLAKLQTAFGADRIADAHLLARAEQSAKQKKLKIWENYIEGQEAANGLVAETRQKEV
LKVVVTEVLGGGKFYVQTVGDQKVASIQQQLASLSLQDAPVIGIFNPKKGDIVLAQFSAD
NSWNRAMIVNAPRGVVESPKDIFEVFYIDYGNQEVVTYSQLRPLDPSVSSAPGLAQLCTL
AYVKIPSLEEDFGQEAAEFLSDRTLNSSRELRAMIEDRDASAGKVKGQGTGTVLIITLVD
VEAGSSINAAMLEEGLARLERRKRWDTKERQLALDQLEEFQDKAKRQRLKMWQYGDIQSD
DEDSAPPARKAGGRR
Download sequence
Identical sequences A0A2G5DAS5
Aquca_025_00377.9|PACid:22063109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]