SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00058.1|PACid:22056023 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00058.1|PACid:22056023
Domain Number 1 Region: 37-231,335-503
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.18e-129
Family Eukaryotic glutathione synthetase ATP-binding domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 234-337
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.77e-35
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00058.1|PACid:22056023
Sequence length 503
Sequence
MSETSSASSTFLPKHGKSEEIDTQDGNSIIPISLNEGVSSKLLQKMVHDALVWCSLHGLV
VGDKNNQRSGKVPGVGIVHAPIALLPMSFAQRHFLQACELTPIFNELVDRVSLDGNFLQD
SLSRTKKVDAFTSRLLDIHSKMLETNKKEEIRLGLHRSDYMLDAQSKDLLQIELNTISCS
FPGLSCLVSEFHRYLLNHYGGDLKLDSTRVPENMASTRYAEALAKAWKEYNNARAVIMIV
VQTEERNMYDQHWLCSILKEKYGVMTIQKTLAEIATEGRLQPDGTLLINDQVVAVIYFRA
GYTPNDYPSESEWSARLLMEQSTAIKCPSISYHLAGTKKIQQELAKPNVLERFLDDKDDV
TKLRKCFAGLWSLDDSKIMKDVMERPELFVLKPQREGGGNNIYGDDVKQMLLKLQKEGSE
ELAAYILMQRIFPTESPAFLVQDGILHEEHVISELGIYGAYLRNKDKVIVNEQCGYLTRT
KVSSSNEGGVVAGFAVLDSVYLT
Download sequence
Identical sequences A0A2G5D765
Aquca_026_00058.1|PACid:22056023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]