SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00058.2|PACid:22056024 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00058.2|PACid:22056024
Domain Number 1 Region: 33-150,254-422
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-103
Family Eukaryotic glutathione synthetase ATP-binding domain 0.0000046
Further Details:      
 
Domain Number 2 Region: 153-256
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.75e-35
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00058.2|PACid:22056024
Sequence length 422
Sequence
MEIQSYPFLLMKGFLQNCFRKWFMMLLFGVLFMDLLLVTKIIRTKKVDAFTSRLLDIHSK
MLETNKKEEIRLGLHRSDYMLDAQSKDLLQIELNTISCSFPGLSCLVSEFHRYLLNHYGG
DLKLDSTRVPENMASTRYAEALAKAWKEYNNARAVIMIVVQTEERNMYDQHWLCSILKEK
YGVMTIQKTLAEIATEGRLQPDGTLLINDQVVAVIYFRAGYTPNDYPSESEWSARLLMEQ
STAIKCPSISYHLAGTKKIQQELAKPNVLERFLDDKDDVTKLRKCFAGLWSLDDSKIMKD
VMERPELFVLKPQREGGGNNIYGDDVKQMLLKLQKEGSEELAAYILMQRIFPTESPAFLV
QDGILHEEHVISELGIYGAYLRNKDKVIVNEQCGYLTRTKVSSSNEGGVVAGFAVLDSVY
LT
Download sequence
Identical sequences A0A2G5D758
Aquca_026_00058.2|PACid:22056024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]