SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00070.1|PACid:22055873 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00070.1|PACid:22055873
Domain Number 1 Region: 900-1268
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.59e-139
Family Pyruvate phosphate dikinase, N-terminal domain 0.0000000000181
Further Details:      
 
Domain Number 2 Region: 1408-1761
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.28e-126
Family Pyruvate phosphate dikinase, C-terminal domain 0.0000000000378
Further Details:      
 
Domain Number 3 Region: 1276-1400
Classification Level Classification E-value
Superfamily Phosphohistidine domain 4.45e-37
Family Pyruvate phosphate dikinase, central domain 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00070.1|PACid:22055873
Sequence length 1762
Sequence
MSAEKSKGSSGEDSPDISSPALIEEKGSRNKRKFISDPHVGDLNKPPSCSKNECQGYEFS
AERFQNIPKHEKCGLCDACRCNQDSPDASKLELIQSPPEDSANLESVQPRVEQSKGLPDA
DWSDLTETQLEELCLHNLDLIFKSIIKTIVASGYSEDVATEAVLRVDLSYGCKDTMSNIV
DNTLAVLKSGRELDPSKEHLFESLEQLEKYILAEMVCVVREVNPHFNTGDAMWCLLICDM
NVSHACAMDSDSLSTIDSNEAAGESSSASMVPQLKEDITEDNHPDNSSVVTPKGSQSEMP
AVKGIPNLPSPCERRLPEKTNPTSTSDNIKKALAVIDERVQAKSQSYISSEKPVVTRKGQ
ASGVKRETILRQKIQYRGALRTGKISGFGGLFMDKKLKSVSDSINIHSKNASMKIKKAIE
VNIAEAEENFHQMKKTMEVTIAQAEGSCHLSVNVGTSKSSTSNKKTVNNPPVLPKGDAEQ
ALPPPSKSNAASNPTTSSVVVHDISHYGIPYDKATGKWVPNDKQDAVILKLASTAQELQS
QLGEWTDWAYQKVMQATRRLSKDKAELKALKQEKEEVERVQKERQSGEESTMKQLSEMEN
ALAKATGQVEKADATVRKLEAEKSKLKLGMEEAKKRYAEASESYREASRREKKIMKKLQS
LESQNTSLQEDLAMVKRRRGQLEQEVEKAQMYLNQLEVRQKQVKREKEEVLLHLESSRKE
REQIEASAKLEDNTLRMRSGNKLQRHQDNIRDLQAQIFRLRLKISPSKMPALNWGRDGSH
INRLTDQGKMSFAMKGIVVRSAPEVHVQKLLKDKYVDQIGLLSGSFRSKRVNSSVVRVRA
ANDDDITHGFPDSKPGKFELRLVRSRSPSRSGALLTPDTSQTSQKPHGKKRVFNFGKGRS
DGNKSMKSLLGGKGANLAEMASIGLSVPPGLTISTEACQEYQLVGKTLPEGLWEEIIEGL
ECVEKDMGAFLGDPLKPLLLSVRSGAAISMPGMMDTVLNLGLNDEVVAGLAAKSGERFAY
DSYRRFLDMFGNVVMGIPHSLFEEKLEQLKEAKGVKLDTDLKASDLKELVSQYKEVYLEA
KGEQFPSDPKKQLLLAIQAVFDSWDSPRAIKYRSINQITGLKGTAVNIQCMVFGNMGNTS
GTGVLFTRNPSTGENKLYGEFLINAQGEDVVAGIRTPEDLDVMKQSMPGAYEELVENCEI
LEGHYKDMMDIEFTVQENRLWMLQCRSGKRTGKGAVKIAVDMVNEGLVDTRSAIKMVEPQ
HLDQLLHPQFEDPSAYKDKVVATGLPASPGAAVGTIVFSSDDAEAWHAQGKSVILVRTET
SPEDIGGMHAAAGILTARGGMTSHAAVVARGWGKCCVSGCADVRVNDAEKVVSIGDQVLQ
EGDWLSLNGSTGEVIIGKQPLSPPALSGDLEIFMSWVDEVRLLKVMANADTPEDALTARN
NGAQGIGLCRTEHMFFASDERIKAVRQMIMAVTVEQRKAALDLLLPYQRSDFEGIFRAMD
GLPVTIRLLDPPLHEFLPEGDIEQIVGELTSYTGMTEDEVFTRIEKLSEVNPMLGFRGCR
LGISYPELTEMQARAIFQAALIMSSQGVKVFPEIMVPLIGTPQELEHQVSLIGTVAEKVF
YEMGASIKYKVGTMIEIPRAALVADEIAEHVEFFSFGTNDLTQMTFGYSRDDVGKFLPIY
LSKGILQSDPFEVLDQKGVGQLIKMATERGRSAKPGLKVGICGEHGGEPSSVAFFAEAGL
DYVSCSPFRVPIARLAAAQVAL
Download sequence
Identical sequences A0A2G5D826
Aquca_026_00070.1|PACid:22055873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]