SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00101.3|PACid:22055967 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00101.3|PACid:22055967
Domain Number 1 Region: 140-256
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.00000192
Family FtsH protease domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00101.3|PACid:22055967
Sequence length 257
Sequence
MGFVIYQNSFCSRFGMGFQINRGIDCSARVEPSTLRRRVLRKVDNELAKGNTKGALTLVK
QLQGKPGGLRGFGAAKQVPYRHYTLDGLNLNETEIASFQTVVDSTLDSVERSLQFAALDM
ASSAEEMETLMLDRTDPTPSEKYHNMCKQHEAGHFLIAYLIGILPKGYIIPRMEDMEDES
VGGRVDLIGFEFLNSVSTKTFPKIKAGSGKVCATVNRAKVSNKNLNTFSCVALAGLAAEC
LVFGYSEGSFCDVEKVR
Download sequence
Identical sequences A0A2G5D7C7
Aquca_026_00101.3|PACid:22055967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]