SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00102.5|PACid:22056000 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_026_00102.5|PACid:22056000
Domain Number - Region: 33-94
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 0.0167
Family Family 10 polysaccharide lyase 0.033
Further Details:      
 
Domain Number - Region: 161-205
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.034
Family FtsH protease domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00102.5|PACid:22056000
Sequence length 233
Sequence
MGMVIQCGGLFSYPRLKHGVVRIRIACSSEAGVVGTSDLDSGVLRLKVLEQVDKELAKGK
EREALSLVKDLQGKPGGLRCFGAVRQVPQRLYTLDELKLNGIDASSILSPEDTTLGSIER
SLQVASALGGVVAWSVFGLTQQQILYLSVGLLFIWSLDLVNTGKVSSSMLNKFSCISLAG
VATEYILFGYSEGGLSDIYQLDGLLKGLGIYTKEGRLSSKMGYIKHYLNFASS
Download sequence
Identical sequences A0A2G5D7D0
Aquca_026_00102.5|PACid:22056000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]